 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EcC054113.90 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
| Family |
SRS |
| Protein Properties |
Length: 111aa MW: 11574.7 Da PI: 4.3394 |
| Description |
SRS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EcC054113.90 | genome | ECGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF702 | 84.8 | 2.1e-26 | 7 | 58 | 103 | 154 |
DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
+slP +v+++avf+cvrv+svddge+e+aYq++v+igGhvfkG+Lyd+G+ee
EcC054113.90 7 ESLPGQVRAPAVFKCVRVTSVDDGEDEYAYQAVVKIGGHVFKGFLYDRGVEE 58
67***********************************************997 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006433 | Biological Process | prolyl-tRNA aminoacylation |
| GO:0006468 | Biological Process | protein phosphorylation |
| GO:0055114 | Biological Process | oxidation-reduction process |
| GO:0005737 | Cellular Component | cytoplasm |
| GO:0016020 | Cellular Component | membrane |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0004672 | Molecular Function | protein kinase activity |
| GO:0004827 | Molecular Function | proline-tRNA ligase activity |
| GO:0005506 | Molecular Function | iron ion binding |
| GO:0005515 | Molecular Function | protein binding |
| GO:0005524 | Molecular Function | ATP binding |
| GO:0016705 | Molecular Function | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0016788 | Molecular Function | hydrolase activity, acting on ester bonds |
| GO:0016887 | Molecular Function | ATPase activity |
| GO:0020037 | Molecular Function | heme binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}. |
| Best hit in Arabidopsis thaliana ? help
Back to Top |
| Hit ID |
E-value |
Description |
| AT5G12330.2 | 3e-37 | Lateral root primordium (LRP) protein-related |
