PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC054026.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 168aa MW: 19813.7 Da PI: 10.4177 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.2 | 8e-18 | 13 | 57 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT+eEd+ l+ av+++ g++Wk+Ia++++ +R + qc +rw k+l EcC054026.10 13 GWTEEEDKVLIAAVQEYNGKSWKKIAERVP-NRNDVQCLHRWKKVL 57 5*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 62.6 | 8.1e-20 | 63 | 109 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd+l+v +v + G+ +W+ Ia++++ gR +kqc++rw+++l EcC054026.10 63 KGPWSKEEDDLIVALVSKKGTSNWSEIAKHLP-GRIGKQCRERWHNHL 109 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 53.9 | 4.3e-17 | 115 | 157 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r +WT eE++ l++a+k +G++ W+ Ia+ + gRt++++k++w+ EcC054026.10 115 RTAWTREEELTLIEAHKVYGNK-WAEIAKLLK-GRTENMIKNHWN 157 679*******************.********9.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.346 | 6 | 57 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-14 | 10 | 59 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.79E-18 | 12 | 74 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.4E-16 | 13 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.4E-23 | 13 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.86E-12 | 14 | 57 | No hit | No description |
PROSITE profile | PS51294 | 32.015 | 58 | 113 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.12E-32 | 60 | 156 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-18 | 62 | 111 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-19 | 63 | 109 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.58E-13 | 65 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.8E-28 | 70 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-15 | 114 | 162 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.201 | 114 | 164 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.1E-15 | 115 | 157 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.47E-10 | 117 | 157 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-21 | 117 | 164 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
RETGPRRRST IGGWTEEEDK VLIAAVQEYN GKSWKKIAER VPNRNDVQCL HRWKKVLDPD 60 LVKGPWSKEE DDLIVALVSK KGTSNWSEIA KHLPGRIGKQ CRERWHNHLK PDIRRTAWTR 120 EEELTLIEAH KVYGNKWAEI AKLLKGRTEN MIKNHWNCSL RKRVEHQL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 2e-64 | 12 | 164 | 9 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-64 | 12 | 164 | 9 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00466 | DAP | Transfer from AT4G32730 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. | |||||
UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018728613.1 | 1e-101 | PREDICTED: myb-related protein 3R-1 | ||||
Swissprot | Q6R032 | 7e-76 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
Swissprot | Q9S7G7 | 1e-75 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | A0A2C9VV92 | 2e-90 | A0A2C9VV92_MANES; Uncharacterized protein | ||||
STRING | XP_010058150.1 | 1e-118 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1667 | 28 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G02320.2 | 3e-78 | myb domain protein 3r-5 |
Publications ? help Back to Top | |||
---|---|---|---|
|