![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC050436.30 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 158aa MW: 17840.5 Da PI: 11.1403 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.8 | 5.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rgrWT+eEde+l ++++ +G g+W++ ++ g+ R++k+c++rw +yl EcC050436.30 14 RGRWTAEEDEILTNYIQAHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61 8*******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.4e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ T+eE++l+v+++ lG++ W++Ia +++ gRt++++k++w+++l EcC050436.30 67 RGNITAEEEKLIVQLHGTLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112 7999******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.117 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.24E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.5E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.55E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.218 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-25 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.55E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0008152 | Biological Process | metabolic process | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003824 | Molecular Function | catalytic activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MGRAPCCEKV GLKRGRWTAE EDEILTNYIQ AHGEGSWRSL PKNAGLLRCG KSCRLRWINY 60 LRSDLKRGNI TAEEEKLIVQ LHGTLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRKIYVAR 120 PSTSARVEPS LPTPMNAVKI AGTGKRRGRT SRSSMRKS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010052493.1 | 1e-110 | PREDICTED: transcription factor MYB12 | ||||
Swissprot | O22264 | 2e-79 | MYB12_ARATH; Transcription factor MYB12 | ||||
TrEMBL | A0A059DBM8 | 1e-101 | A0A059DBM8_EUCGR; Uncharacterized protein | ||||
STRING | XP_010052493.1 | 1e-109 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 6e-77 | myb domain protein 12 |