PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC050054.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 144aa MW: 16718 Da PI: 10.4007 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.9 | 1.3e-19 | 37 | 83 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEde+l +av+++ g++Wk+Ia+++ Rt+ qc +rwqk+l EcC050054.20 37 KGQWTAEEDEILRKAVERFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83 799****************************9.************986 PP | |||||||
2 | Myb_DNA-binding | 70.5 | 2.8e-22 | 89 | 135 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEde++v++v+++G++ W+tIa++++ gR +kqc++rw+++l EcC050054.20 89 KGPWSKEEDEIIVELVNKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135 79******************************.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.327 | 32 | 83 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.64E-16 | 33 | 86 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-15 | 36 | 85 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-17 | 37 | 83 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.5E-24 | 38 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.11E-13 | 40 | 83 | No hit | No description |
SuperFamily | SSF46689 | 7.05E-27 | 69 | 144 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 33.357 | 84 | 139 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-19 | 88 | 137 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-20 | 89 | 135 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.96E-16 | 91 | 135 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.0E-29 | 92 | 144 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MESERTASAP SDGSRDGVPR ARPLHGRTSG PTRRSTKGQW TAEEDEILRK AVERFKGKNW 60 KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII VELVNKYGPK KWSTIAQHLP 120 GRIGKQCRER WHNHLNPAIN KEAW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 7e-49 | 37 | 144 | 6 | 155 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 7e-49 | 37 | 144 | 6 | 155 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010049083.1 | 2e-98 | PREDICTED: myb-related protein 3R-1 isoform X1 | ||||
Swissprot | Q94FL9 | 4e-74 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
TrEMBL | A0A059CTK7 | 6e-97 | A0A059CTK7_EUCGR; Uncharacterized protein | ||||
STRING | XP_010049083.1 | 1e-97 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11510.2 | 5e-77 | myb domain protein 3r-4 |
Publications ? help Back to Top | |||
---|---|---|---|
|