PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB

Protein Properties

Length: 142aa MW: 16382.5 Da PI: 9.8453

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC048866.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.9	7.4e-16	18	65	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48 +g+WT+ Ede l ++v+++G g+W+++ + g R++k+c++rw+++l EcC048866.10 18 KGPWTPVEDEVLTEYVQEHGEGNWNRVRLHTGiP-RSGKSCRLRWLNHL 65 79****************************77.**********97 PP
2	Myb_DNA-binding	51	3.3e-16	71	114	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+++ eE++l ++++++lG++ W++Ia+ ++ gRt++++k++w++ EcC048866.10 71 KGSFSYEEEKLVLELHARLGNK-WSLIASQLP-GRTDNDIKNFWNT 114 799*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.456	13	65	IPR017930	Myb domain
SuperFamily	SSF46689	3.74E-30	17	112	IPR009057	Homeodomain-like
SMART	SM00717	2.9E-14	17	67	IPR001005	SANT/Myb domain
Pfam	PF00249	2.9E-15	18	65	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-22	19	72	IPR009057	Homeodomain-like
CDD	cd00167	4.71E-11	20	65	No hit	No description
PROSITE profile	PS51294	23.125	66	120	IPR017930	Myb domain
SMART	SM00717	3.1E-13	70	118	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-15	71	114	IPR001005	SANT/Myb domain
CDD	cd00167	1.55E-9	73	114	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.4E-24	73	118	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005975	Biological Process	carbohydrate metabolic process
GO:0006468	Biological Process	protein phosphorylation
GO:0007165	Biological Process	signal transduction
GO:0048193	Biological Process	Golgi vesicle transport
GO:0005783	Cellular Component	endoplasmic reticulum
GO:0003677	Molecular Function	DNA binding
GO:0004553	Molecular Function	hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004672	Molecular Function	protein kinase activity
GO:0005509	Molecular Function	calcium ion binding
GO:0005515	Molecular Function	protein binding
GO:0005524	Molecular Function	ATP binding
GO:0008080	Molecular Function	N-acetyltransferase activity

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MPKKRERSAV EDEELLTKGP WTPVEDEVLT EYVQEHGEGN WNRVRLHTGI PRSGKSCRLR 60 WLNHLRPDLK KGSFSYEEEK LVLELHARLG NKWSLIASQL PGRTDNDIKN FWNTRAKRHE 120 GAGWPLYFPG LPSAGHAPIH GR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-29	16	118	25	126	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269\|PubMed:11743113, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403, ECO:0000269\|PubMed:22101548, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028, ECO:0000269\|PubMed:25268707}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269\|PubMed:15226253, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010034253.1	1e-98	PREDICTED: transcription factor MYB29
Swissprot	O80883	6e-52	MB101_ARATH; Transcription factor MYB101
TrEMBL	A0A199URI0	2e-54	A0A199URI0_ANACO; Transcription factor GAMYB
TrEMBL	U5U1W5	7e-55	U5U1W5_SCUBA; MYB16 (Fragment)
STRING	XP_010034253.1	4e-98	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G32460.2	2e-54	myb domain protein 101

Publications ? help Back to Top
Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145] Xue T,Liu Z,Dai X,Xiang F Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101. Plant Sci., 2017. 262: p. 182-189 [PMID:28716415]