![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC044424.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 63aa MW: 6984.2 Da PI: 10.4741 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.4 | 1.6e-08 | 16 | 47 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g W++ Ed++l+d+vk +G g W ++ + g EcC044424.10 16 KGVWSALEDQILIDYVKVHGQGKWGKVRKVTG 47 799*********************99987655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.156 | 11 | 50 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 8.97E-8 | 12 | 46 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.0E-10 | 12 | 45 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.4E-6 | 16 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.95E-5 | 19 | 47 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 63 aa Download sequence Send to blast |
MGRNPSSGKD GLKLKKGVWS ALEDQILIDY VKVHGQGKWG KVRKVTGELR PLGSYYISPC 60 KLP |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010049278.1 | 9e-25 | PREDICTED: transcription factor WER | ||||
Refseq | XP_010051337.1 | 1e-24 | PREDICTED: transcription factor MYB82 | ||||
TrEMBL | A0A059CTT8 | 2e-23 | A0A059CTT8_EUCGR; Uncharacterized protein | ||||
TrEMBL | A0A059CUD0 | 2e-23 | A0A059CUD0_EUCGR; Uncharacterized protein | ||||
STRING | XP_010049278.1 | 3e-24 | (Eucalyptus grandis) | ||||
STRING | XP_010051337.1 | 4e-24 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 2e-08 | myb domain protein 23 |