 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EcC038455.10 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
| Family |
BES1 |
| Protein Properties |
Length: 109aa MW: 12914 Da PI: 11.9301 |
| Description |
BES1 family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EcC038455.10 | genome | ECGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF822 | 162.2 | 3.2e-50 | 2 | 76 | 1 | 76 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76
++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrk kp
EcC038455.10 2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWTVEEDGTTYRKV-KPA 76
5899******************************************************************64.444 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 5zd4_A | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 1e-23 | 6 | 75 | 372 | 442 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase |
