PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcC037314.20

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 69aa MW: 8006.4 Da PI: 10.2914

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC037314.20	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.9	3.5e-30	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRrng+lKKA+ELSvLCdaeva iifs++g+lye+ss EcC037314.20 10 RIENVTSRQVTFSKRRNGLLKKAYELSVLCDAEVAAIIFSQKGRLYEFSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.861	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.5E-39	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-31	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.41E-37	3	61	No hit	No description
SuperFamily	SSF55455	2.75E-29	3	61	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
MVRGKIQMRR IENVTSRQVT FSKRRNGLLK KAYELSVLCD AEVAAIIFSQ KGRLYEFSSN 60 SEYVCILIF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_Q	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_R	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_S	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_A	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_B	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_C	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_D	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_E	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_F	5e-18	1	61	1	61	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010035074.1	1e-35	PREDICTED: MADS-box protein AGL42
Swissprot	Q9FIS1	1e-30	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A058ZZ53	2e-34	A0A058ZZ53_EUCGR; Uncharacterized protein
STRING	XP_010035074.1	4e-35	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.4	5e-33	AGAMOUS-like 42