PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC032382.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 136aa MW: 15935.7 Da PI: 10.3737 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.4 | 1.2e-25 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri + rqvtf kRr+g+lKKA+ELS+LCdae+ viifs tgklyey+s EcC032382.10 10 RITSPKSRQVTFFKRRTGLLKKAKELSILCDAEIGVIIFSCTGKLYEYAS 59 7899999*****************************************86 PP | |||||||
2 | K-box | 64.6 | 3.6e-22 | 59 | 123 | 34 | 98 |
K-box 34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + R+l+Ge+L++Lsl++L++Le+ Le +lk++Rs+K++ ++e+++el++k ++ ++en +Lrkkl EcC032382.10 59 STRQLMGEELSKLSLEDLKNLENVLEMGLKNVRSRKDQTFMEEMRELKRKADDFEQENVELRKKL 123 57*************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 27.74 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.0E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-25 | 3 | 69 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.919 | 37 | 129 | IPR002487 | Transcription factor, K-box |
PRINTS | PR00404 | 2.6E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 9.0E-20 | 58 | 123 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MVKGKIAIRR ITSPKSRQVT FFKRRTGLLK KAKELSILCD AEIGVIIFSC TGKLYEYAST 60 RQLMGEELSK LSLEDLKNLE NVLEMGLKNV RSRKDQTFME EMRELKRKAD DFEQENVELR 120 KKLRVLSRDH REIKGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 8e-18 | 1 | 60 | 1 | 60 | MEF2C |
5f28_B | 8e-18 | 1 | 60 | 1 | 60 | MEF2C |
5f28_C | 8e-18 | 1 | 60 | 1 | 60 | MEF2C |
5f28_D | 8e-18 | 1 | 60 | 1 | 60 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010029957.1 | 4e-80 | PREDICTED: MADS-box transcription factor 23-like isoform X1 | ||||
Refseq | XP_018717821.1 | 4e-80 | PREDICTED: MADS-box transcription factor 23-like isoform X1 | ||||
Refseq | XP_018717822.1 | 4e-80 | PREDICTED: MADS-box transcription factor 23-like isoform X1 | ||||
Swissprot | A2RVQ5 | 2e-41 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A368UI61 | 2e-50 | A0A368UI61_SOYBN; Uncharacterized protein | ||||
STRING | XP_010029957.1 | 1e-79 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 3e-33 | AGAMOUS-like 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|