![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC026037.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 54aa MW: 6133.38 Da PI: 10.5453 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 55.6 | 6.6e-18 | 11 | 52 | 3 | 44 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44 i n+ r +t+ kR++g++KKA+E +LC+++ ++ii+++ g EcC026037.10 11 IPNEKARRITYEKRKKGMMKKAQEFTTLCGVDTCMIIYGPAG 52 88999**********************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 4.71E-19 | 1 | 52 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 18.25 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.0E-14 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 1.55E-19 | 2 | 53 | No hit | No description |
PRINTS | PR00404 | 6.4E-12 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.8E-18 | 11 | 52 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-12 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.4E-12 | 38 | 54 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 54 aa Download sequence Send to blast |
MGRRKLVLEL IPNEKARRIT YEKRKKGMMK KAQEFTTLCG VDTCMIIYGP AGSA |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010037296.1 | 1e-29 | PREDICTED: agamous-like MADS-box protein AGL82 | ||||
Refseq | XP_018720655.1 | 1e-29 | PREDICTED: agamous-like MADS-box protein AGL82 | ||||
TrEMBL | A0A059A6L7 | 2e-28 | A0A059A6L7_EUCGR; Uncharacterized protein | ||||
STRING | XP_010037296.1 | 4e-29 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM70 | 28 | 415 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G55690.1 | 3e-17 | M-type_MADS family protein |