PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB

Protein Properties

Length: 180aa MW: 21058.3 Da PI: 9.9142

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC023451.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.4	8.9e-15	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l EcC023451.10 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78***************************.**********986 PP
2	Myb_DNA-binding	32.4	2.1e-10	60	103	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k++++ W+tIa + Rt+ qc +r+ k+l EcC023451.10 60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVV--RTPSQCLERYEKLL 103 68***************99.****9..********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.008	2	57	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.3E-19	5	56	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	6	55	IPR001005	SANT/Myb domain
Pfam	PF13921	3.6E-14	10	70	No hit	No description
CDD	cd00167	1.32E-11	10	53	No hit	No description
SuperFamily	SSF46689	1.2E-20	33	107	IPR009057	Homeodomain-like
CDD	cd11659	9.00E-30	55	106	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.5E-14	57	104	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.799	58	107	IPR017930	Myb domain
SMART	SM00717	1.3E-11	58	105	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT 60 EWTREEDEKL LHLAKLMPTQ WRTIAPIVVR TPSQCLERYE KLLDAACAKD ENYEPGDDPR 120 KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
5xjc_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
5yzg_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
5z56_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
5z57_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
5z58_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
6ff4_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
6ff7_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
6icz_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
6id0_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
6id1_L	2e-97	2	180	3	181	Cell division cycle 5-like protein
6qdv_O	2e-97	2	180	3	181	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010039520.1	1e-122	PREDICTED: cell division cycle 5-like protein isoform X2
Refseq	XP_015875524.1	1e-124	cell division cycle 5-like protein
Refseq	XP_015875562.1	1e-123	cell division cycle 5-like protein
Refseq	XP_017258014.1	1e-122	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	1e-112	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A067DSG9	1e-125	A0A067DSG9_CITSI; Uncharacterized protein
TrEMBL	A0A2H5Q009	1e-123	A0A2H5Q009_CITUN; Uncharacterized protein
STRING	evm.model.supercontig_306.1	1e-124	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16532	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	1e-109	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]