![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC023451.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 180aa MW: 21058.3 Da PI: 9.9142 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.4 | 8.9e-15 | 8 | 53 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l EcC023451.10 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 32.4 | 2.1e-10 | 60 | 103 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k++++ W+tIa + Rt+ qc +r+ k+l EcC023451.10 60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVV--RTPSQCLERYEKLL 103 68*****************99.********9..**********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.008 | 2 | 57 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-19 | 5 | 56 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.0E-15 | 6 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF13921 | 3.6E-14 | 10 | 70 | No hit | No description |
CDD | cd00167 | 1.32E-11 | 10 | 53 | No hit | No description |
SuperFamily | SSF46689 | 1.2E-20 | 33 | 107 | IPR009057 | Homeodomain-like |
CDD | cd11659 | 9.00E-30 | 55 | 106 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-14 | 57 | 104 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.799 | 58 | 107 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-11 | 58 | 105 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT 60 EWTREEDEKL LHLAKLMPTQ WRTIAPIVVR TPSQCLERYE KLLDAACAKD ENYEPGDDPR 120 KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
5xjc_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
5yzg_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
5z56_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
5z57_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
5z58_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
6ff4_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
6ff7_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
6icz_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
6id0_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
6id1_L | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
6qdv_O | 2e-97 | 2 | 180 | 3 | 181 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010039520.1 | 1e-122 | PREDICTED: cell division cycle 5-like protein isoform X2 | ||||
Refseq | XP_015875524.1 | 1e-124 | cell division cycle 5-like protein | ||||
Refseq | XP_015875562.1 | 1e-123 | cell division cycle 5-like protein | ||||
Refseq | XP_017258014.1 | 1e-122 | PREDICTED: cell division cycle 5-like protein | ||||
Swissprot | P92948 | 1e-112 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A067DSG9 | 1e-125 | A0A067DSG9_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5Q009 | 1e-123 | A0A2H5Q009_CITUN; Uncharacterized protein | ||||
STRING | evm.model.supercontig_306.1 | 1e-124 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16532 | 9 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 1e-109 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|