![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC019852.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 119aa MW: 13954.2 Da PI: 11.2125 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.8 | 2.9e-14 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l +++++G +W+ ++ g+ Rt+k+c++rw +yl EcC019852.20 18 KGTWSAEEDQKLTAYIRRYGIWNWAHMPKPAGLARTGKSCRLRWMNYL 65 799*****************99************************97 PP | |||||||
2 | Myb_DNA-binding | 52.1 | 1.5e-16 | 72 | 114 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g+ T+eE++l++++ ++lG++ W++Ia++++ gRt++++k++w++ EcC019852.20 72 GNITKEEEDLIIKLQQLLGNK-WAAIAARLP-GRTDNEIKNYWNT 114 678******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.871 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.18E-29 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-9 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-12 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-22 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.65E-8 | 20 | 65 | No hit | No description |
PROSITE profile | PS51294 | 24.813 | 66 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-15 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-15 | 72 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-25 | 73 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.26E-10 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MVGRPLRPNK SSDPTVKKGT WSAEEDQKLT AYIRRYGIWN WAHMPKPAGL ARTGKSCRLR 60 WMNYLRPNIR HGNITKEEED LIIKLQQLLG NKWAAIAARL PGRTDNEIKN YWNTRLKKR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-28 | 14 | 119 | 3 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010051859.1 | 4e-82 | PREDICTED: transcription repressor MYB5 | ||||
Swissprot | Q7XBH4 | 9e-47 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | A0A059CCL1 | 9e-81 | A0A059CCL1_EUCGR; Uncharacterized protein | ||||
STRING | XP_010051859.1 | 1e-81 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28110.1 | 1e-48 | myb domain protein 41 |
Publications ? help Back to Top | |||
---|---|---|---|
|