PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB

Protein Properties

Length: 116aa MW: 13622.5 Da PI: 10.9182

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC019654.30	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53	7.8e-17	1	46	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +WT+eEd++l+ ++q+G +W++ +r g+ R++k+c++rw +yl EcC019654.30 1 PWTPEEDQILISHIHQFGHSNWRALPRQAGLLRCGKSCRLRWINYL 46 7***************************99**********97 PP
2	Myb_DNA-binding	52.8	9.3e-17	52	97	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E + ++++++ lG++ W++Ia++++ gRt++++k++w+++l EcC019654.30 52 RGNFTDDERDTIIQLHQVLGNR-WSAIASRLP-GRTDNEIKNFWHTHL 97 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.1E-24	1	53	IPR009057	Homeodomain-like
Pfam	PF00249	1.0E-14	1	46	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.09E-28	1	93	IPR009057	Homeodomain-like
SMART	SM00717	8.1E-9	1	48	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	15.095	1	46	IPR017930	Myb domain
CDD	cd00167	3.09E-11	1	46	No hit	No description
PROSITE profile	PS51294	24.701	47	101	IPR017930	Myb domain
SMART	SM00717	9.0E-16	51	99	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-15	52	97	IPR001005	SANT/Myb domain
CDD	cd00167	2.91E-11	54	97	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.7E-26	54	100	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006468	Biological Process	protein phosphorylation
GO:0009416	Biological Process	response to light stimulus
GO:0016036	Biological Process	cellular response to phosphate starvation
GO:0046898	Biological Process	response to cycloheximide
GO:0003677	Molecular Function	DNA binding
GO:0004674	Molecular Function	protein serine/threonine kinase activity
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
PWTPEEDQIL ISHIHQFGHS NWRALPRQAG LLRCGKSCRL RWINYLRPDV KRGNFTDDER 60 DTIIQLHQVL GNRWSAIASR LPGRTDNEIK NFWHTHLKKR VPHSLPNSTP FTINPT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-28	1	101	9	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269\|PubMed:24415840}.
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.
UniProt	INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:24415840}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010046353.1	3e-83	PREDICTED: myb-related protein Myb4
Swissprot	Q9LTC4	5e-60	MYB15_ARATH; Transcription factor MYB15
Swissprot	Q9SJX8	3e-60	MYB14_ARATH; Transcription factor MYB14
TrEMBL	A0A059D482	7e-82	A0A059D482_EUCGR; Uncharacterized protein
STRING	XP_010046353.1	1e-82	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31180.1	1e-62	myb domain protein 14

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen Y, et al. AtMYB14 Regulates Cold Tolerance in Arabidopsis. Plant Mol. Biol. Rep., 2013. 31: p. 87-97 [PMID:24415840] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]