PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 122aa MW: 13437.2 Da PI: 11.9146

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcC018717.40	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	40.1	8.5e-13	27	74	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+ +Ede l ++v++ Ggg+W+ + r+ ++ R++k+ ++rw ++l EcC018717.40 27 KGMWSRQEDEMLTKYVRRNGGGNWNMVQRHTPLLRCGKSYRLRWANHL 74 688***************************99********9996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.237	22	78	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-17	22	77	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-6	26	76	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.99E-19	28	103	IPR009057	Homeodomain-like
CDD	cd00167	4.13E-6	30	74	No hit	No description
Pfam	PF13921	2.7E-10	30	90	No hit	No description
PROSITE profile	PS50090	4.913	75	122	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	9.9E-10	78	109	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0055114	Biological Process	oxidation-reduction process
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MNGGGGGGGR GGRGGGGEER PKKIRKKGMW SRQEDEMLTK YVRRNGGGNW NMVQRHTPLL 60 RCGKSYRLRW ANHLRPDLKK GAFSPEKESL VARLHAKHGN KWAHKASQVR ASSSSSSSQA 120 LS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	7e-13	27	106	4	82	MYB PROTO-ONCOGENE PROTEIN
1mse_C	7e-13	27	106	4	82	C-Myb DNA-Binding Domain
1msf_C	7e-13	27	106	4	82	C-Myb DNA-Binding Domain
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	10	16	GGRGGGG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB101 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250\|UniProtKB:O80883, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028}.
UniProt	Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269\|PubMed:11743113, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403, ECO:0000269\|PubMed:22101548, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028, ECO:0000269\|PubMed:25268707}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269\|PubMed:15226253, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018720345.1	3e-47	PREDICTED: myb-related protein Myb4-like
Swissprot	O80883	4e-33	MB101_ARATH; Transcription factor MYB101
Swissprot	Q9S773	2e-33	MYB97_ARATH; Transcription factor MYB97
TrEMBL	A0A067L3R9	5e-35	A0A067L3R9_JATCU; MYB family protein
STRING	XP_010038599.1	2e-46	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G32460.1	3e-35	myb domain protein 101

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145] Xue T,Liu Z,Dai X,Xiang F Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101. Plant Sci., 2017. 262: p. 182-189 [PMID:28716415]