![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC017924.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 122aa MW: 14260.5 Da PI: 11.2154 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.3 | 5.4e-16 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++lv ++k++G +W+ a+ g+ Rt+k+c++rw +yl EcC017924.20 18 KGAWSAEEDQKLVAYIKRYGIWNWAHMAKPAGLARTGKSCRLRWMNYL 65 79******************99************************97 PP | |||||||
2 | Myb_DNA-binding | 50.7 | 4.1e-16 | 72 | 114 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g+ T+eE+e ++ +++ lG++ W++Ia++++ gRt++++k++w++ EcC017924.20 72 GNITKEEEETIIVLHRVLGNR-WAAIAARLP-GRTDNEIKNYWNT 114 678******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.004 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.39E-30 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-11 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-14 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.2E-24 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.17E-9 | 20 | 65 | No hit | No description |
PROSITE profile | PS51294 | 23.961 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 5.7E-15 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-14 | 72 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-25 | 73 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.80E-10 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MARYPRNGKS NNKTAVKKGA WSAEEDQKLV AYIKRYGIWN WAHMAKPAGL ARTGKSCRLR 60 WMNYLRPNIK HGNITKEEEE TIIVLHRVLG NRWAAIAARL PGRTDNEIKN YWNTRLRKRV 120 SE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-31 | 18 | 121 | 7 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010051856.1 | 2e-83 | PREDICTED: myb-related protein 308 | ||||
Swissprot | Q9LDR8 | 4e-49 | MY102_ARATH; Transcription factor MYB102 | ||||
Swissprot | Q9M0J5 | 9e-50 | MYB41_ARATH; Transcription factor MYB41 | ||||
TrEMBL | A0A059CBW5 | 5e-82 | A0A059CBW5_EUCGR; Uncharacterized protein | ||||
STRING | XP_010051856.1 | 9e-83 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28110.1 | 4e-52 | myb domain protein 41 |
Publications ? help Back to Top | |||
---|---|---|---|
|