PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC009286.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 150aa MW: 17421.7 Da PI: 6.2783 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 108.8 | 6.5e-34 | 18 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF+Ptdeelv ++L++k ++ + +l + +++++ ++++PwdL+ k+ ++ ++ yf+++r +nr+t++gyWk +++v+ + EcC009286.20 18 LPPGFRFSPTDEELVLHFLHPKKQQASlSPLYAHlVPDLKSHHHDPWDLHGKALSNGSH-YFYFSRM-------MNNRITENGYWKDLDMEEPVFGE 106 79********************99999533434459*************9555444444.5554443.......358******************** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ge +g+kk+L+f+ g+ap+g++t+Wvm+ey+l EcC009286.20 107 AGEIIGMKKSLTFHIGEAPTGQETNWVMQEYHL 139 *******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.8E-38 | 15 | 143 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 36.305 | 18 | 150 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-22 | 19 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MRDVKEKEEK DDGKMLKLPP GFRFSPTDEE LVLHFLHPKK QQASLSPLYA HLVPDLKSHH 60 HDPWDLHGKA LSNGSHYFYF SRMMNNRITE NGYWKDLDME EPVFGEAGEI IGMKKSLTFH 120 IGEAPTGQET NWVMQEYHLV SFHELANSTQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-27 | 8 | 150 | 7 | 153 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-27 | 8 | 150 | 7 | 153 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-27 | 8 | 150 | 7 | 153 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-27 | 8 | 150 | 7 | 153 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swm_B | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swm_C | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swm_D | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swp_A | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swp_B | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swp_C | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
3swp_D | 2e-27 | 8 | 150 | 10 | 156 | NAC domain-containing protein 19 |
4dul_A | 2e-27 | 8 | 150 | 7 | 153 | NAC domain-containing protein 19 |
4dul_B | 2e-27 | 8 | 150 | 7 | 153 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010027640.1 | 1e-109 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 6e-40 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A059AJK6 | 1e-108 | A0A059AJK6_EUCGR; Uncharacterized protein | ||||
TrEMBL | A0A059AKH9 | 1e-108 | A0A059AKH9_EUCGR; Uncharacterized protein | ||||
STRING | XP_010027640.1 | 1e-109 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 6e-42 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|