![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC005170.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 112aa MW: 12775.9 Da PI: 8.6601 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 72.1 | 7.2e-23 | 13 | 70 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+W+KYGqK +++ rsYY+C a+C++kk+ e s+++p + ++Yeg Hnh+ EcC005170.20 13 QDGYEWKKYGQKFIRNIGKFRSYYKCQRAECNAKKRAEWSETEPGDLRVVYEGVHNHS 70 7********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.4E-23 | 5 | 70 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 20.048 | 7 | 72 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.16E-21 | 8 | 70 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.4E-19 | 12 | 71 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.1E-20 | 13 | 69 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006508 | Biological Process | proteolysis | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0004252 | Molecular Function | serine-type endopeptidase activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MDREASSRLQ LPQDGYEWKK YGQKFIRNIG KFRSYYKCQR AECNAKKRAE WSETEPGDLR 60 VVYEGVHNHS SSLQDQSGSS QSGASSTSAN QYNLLNQVFG DNPPSDYRRS GD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-14 | 4 | 69 | 9 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-14 | 4 | 69 | 9 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012075800.1 | 2e-42 | probable WRKY transcription factor 45 | ||||
TrEMBL | A0A059AF13 | 2e-77 | A0A059AF13_EUCGR; Uncharacterized protein | ||||
STRING | XP_006488951.1 | 3e-37 | (Citrus sinensis) | ||||
STRING | XP_006445572.1 | 3e-37 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM23988 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47260.1 | 2e-15 | WRKY DNA-binding protein 23 |