![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcC004052.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 154aa MW: 17640.8 Da PI: 10.2567 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.7 | 4.1e-32 | 70 | 128 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYGqK vk+s++prsYYrC+ C+vkk+v+r +ed+++v++tYeg Hnh+ EcC004052.10 70 LDDGFRWRKYGQKAVKNSTHPRSYYRCARIACNVKKQVQRLSEDTSIVVTTYEGIHNHP 128 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.2E-33 | 57 | 129 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-28 | 62 | 129 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.449 | 65 | 130 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.1E-37 | 70 | 129 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.2E-25 | 71 | 128 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
ASAWIDGRGT LDGDAARHEA SLVASEYRTA MEEIRARRLE KRSKAAASSR ARNVASPRFE 60 FQTRSEDDLL DDGFRWRKYG QKAVKNSTHP RSYYRCARIA CNVKKQVQRL SEDTSIVVTT 120 YEGIHNHPSE KIMETLSPLL RQIQLLSRFS PDKQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 61 | 127 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 61 | 127 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00317 | DAP | Transfer from AT2G46130 | Download |
![]() |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010053764.1 | 1e-109 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q8GY11 | 1e-51 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 8e-51 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A059CI98 | 2e-72 | A0A059CI98_EUCGR; Uncharacterized protein | ||||
STRING | XP_010053764.1 | 1e-108 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 5e-51 | WRKY DNA-binding protein 56 |
Publications ? help Back to Top | |||
---|---|---|---|
|