 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EPS72669.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
| Family |
G2-like |
| Protein Properties |
Length: 142aa MW: 15476.4 Da PI: 10.8892 |
| Description |
G2-like family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EPS72669.1 | genome | LSMU | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 103.7 | 1.1e-32 | 18 | 71 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
pr+rWt+ LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
EPS72669.1 18 PRMRWTSSLHARFVHAVDLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 71
9****************************************************7 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0009887 | Biological Process | organ morphogenesis |
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis |
| GO:0009956 | Biological Process | radial pattern formation |
| GO:0010051 | Biological Process | xylem and phloem pattern formation |
| GO:0010158 | Biological Process | abaxial cell fate specification |
| GO:0010229 | Biological Process | inflorescence development |
| GO:0048481 | Biological Process | plant ovule development |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| Sequence ? help Back to Top |
| Protein Sequence Length: 142 aa
Download sequence Send
to blast |
MRSRFLPKIP AKRSMRAPRM RWTSSLHARF VHAVDLLGGH ERATPKSVLE LMDVKDLTLA 60
HVKSHLQMYR TVKTTDKPAA SSGHSDGSGE DDMSTVGSGG GLRQFIGSPP RDSDANFQSS 120
TPPTLWSNSS SGRDGWLQMN GG
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 6j4k_A | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 1e-18 | 19 | 73 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. |
| Publications
? help Back to Top |
- Leushkin EV, et al.
The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
BMC Genomics, 2013. 14: p. 476
[PMID:23855885] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Huang T,Kerstetter RA,Irish VF
APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis.
J. Exp. Bot., 2014. 65(4): p. 1181-91
[PMID:24449383] - Mach J
Getting in Shape? Leaves work it out with KANADI1.
Plant Cell, 2014. 26(1): p. 4
[PMID:24464293] - Jun SE, et al.
Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12.
Mol. Cells, 2015. 38(3): p. 243-50
[PMID:25518926] - Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
[PMID:26108442] - Xie Y, et al.
Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways.
Plant Physiol., 2015. 169(2): p. 1240-53
[PMID:26246448] - Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
Active suppression of a leaf meristem orchestrates determinate leaf growth.
Elife, 2017.
[PMID:27710768] - Singh A, et al.
Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana.
Sci Rep, 2017. 7(1): p. 3408
[PMID:28611467] - Caggiano MP, et al.
Cell type boundaries organize plant development.
Elife, 2018.
[PMID:28895530] - Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
Development, 2018.
[PMID:29361563]
|
