![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS72298.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 153aa MW: 16830.3 Da PI: 8.4065 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 55.2 | 1.4e-17 | 24 | 61 | 3 | 40 |
TCR 3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 +kgCnCkkskClk+YCeCfaag +C + C C dC+Nk EPS72298.1 24 CKGCNCKKSKCLKLYCECFAAGIYCVDLCACIDCFNKP 61 89**********************************96 PP | |||||||
2 | TCR | 51.8 | 1.6e-16 | 108 | 146 | 1 | 39 |
TCR 1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 ++k+gCnCkks C kkYCeC++ g+ Cs +C+Ce+CkN EPS72298.1 108 RHKRGCNCKKSGCFKKYCECYQGGVGCSINCRCEGCKNA 146 589***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 3.8E-18 | 22 | 63 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 36.285 | 23 | 148 | IPR005172 | CRC domain |
Pfam | PF03638 | 1.8E-13 | 25 | 60 | IPR005172 | CRC domain |
SMART | SM01114 | 7.7E-17 | 108 | 149 | IPR033467 | Tesmin/TSO1-like CXC domain |
Pfam | PF03638 | 4.3E-12 | 110 | 146 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
EDINQISPKK KRRRAEQSGD GEGCKGCNCK KSKCLKLYCE CFAAGIYCVD LCACIDCFNK 60 PVHEETVLAT RKQIESRNPL AFAPKVIRGS DQPSETMDDS STTPASARHK RGCNCKKSGC 120 FKKYCECYQG GVGCSINCRC EGCKNAFGRK DGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5fd3_A | 2e-20 | 25 | 145 | 12 | 120 | Protein lin-54 homolog |
5fd3_B | 2e-20 | 25 | 145 | 12 | 120 | Protein lin-54 homolog |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 8 | 13 | KKKRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011090684.1 | 2e-90 | LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2 | ||||
Swissprot | F4JIF5 | 6e-83 | TCX2_ARATH; Protein tesmin/TSO1-like CXC 2 | ||||
TrEMBL | S8E8T2 | 1e-106 | S8E8T2_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.G00370.1.p | 8e-86 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2467 | 23 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14770.1 | 6e-66 | TESMIN/TSO1-like CXC 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|