![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS71973.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 172aa MW: 18574.6 Da PI: 6.9333 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 186.3 | 2.3e-58 | 22 | 119 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdrflPian+srimkk lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl +yre+eg++k EPS71973.1 22 VREQDRFLPIANISRIMKKGLPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLCRYREMEGDTK 119 69*********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.9E-54 | 17 | 132 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.23E-41 | 25 | 148 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.7E-28 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.6E-20 | 56 | 74 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.6E-20 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 1.6E-20 | 94 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
PGSPPGGGSH DSGGDQSPRS GVREQDRFLP IANISRIMKK GLPANGKIAK DAKETVQECV 60 SEFISFITSE ASDKCQREKR KTINGDDLLW AMATLGFEDY IEPLKVYLCR YREMEGDTKG 120 SAKGPDGSSR KDGSHLSNVG SQLLHHQGSF PQGLNYGSNP PPPPFDDSPA AR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-47 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-47 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009620316.1 | 2e-93 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X4 | ||||
Refseq | XP_016449854.1 | 2e-93 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Swissprot | Q8VYK4 | 2e-82 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | S8E805 | 1e-124 | S8E805_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_009620316.1 | 8e-93 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 3e-76 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|