![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS71772.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 80aa MW: 9164.31 Da PI: 9.4995 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 108.7 | 2.8e-34 | 19 | 77 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK v+g+++prsYY+Cts gC v+k+ver+++dp++v++ Yeg+Hnhe EPS71772.1 19 LDDGYRWRKYGQKLVRGNPNPRSYYKCTSIGCAVRKHVERARNDPNAVITSYEGKHNHE 77 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.8E-37 | 5 | 79 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.22E-30 | 11 | 79 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 37.057 | 14 | 79 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.1E-36 | 19 | 78 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.9E-26 | 20 | 77 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
VEDGKPRVIV QTVSEVDILD DGYRWRKYGQ KLVRGNPNPR SYYKCTSIGC AVRKHVERAR 60 NDPNAVITSY EGKHNHEVPP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-38 | 10 | 79 | 8 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 2e-38 | 10 | 79 | 8 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in starch synthesis (PubMed:12953112). Acts as a transcriptional activator in sugar signaling (PubMed:16167901). Interacts specifically with the SURE and W-box elements, but not with the SP8a element (PubMed:12953112). {ECO:0000269|PubMed:12953112, ECO:0000269|PubMed:16167901}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by sugar. {ECO:0000269|PubMed:12953112}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019460531.1 | 2e-41 | PREDICTED: probable WRKY transcription factor 20 isoform X1 | ||||
Refseq | XP_019460532.1 | 1e-41 | PREDICTED: probable WRKY transcription factor 20 isoform X2 | ||||
Refseq | XP_028758455.1 | 5e-42 | probable WRKY transcription factor 20 | ||||
Swissprot | Q6VWJ6 | 2e-41 | WRK46_HORVU; WRKY transcription factor SUSIBA2 | ||||
TrEMBL | S8EGG5 | 3e-52 | S8EGG5_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_010683807.1 | 5e-40 | (Beta vulgaris) | ||||
STRING | evm.model.supercontig_12.196 | 4e-40 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G26640.1 | 2e-42 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|