PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Function |

Regulation |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

EPS71642.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

ZF-HD

Protein Properties

Length: 57aa MW: 6201.09 Da PI: 8.1307

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS71642.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	91.9	5.9e-29	3	55	3	56
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 v+Y+eC+kNhAa +G avDGC+Efmp+ geeg+ aal+CaAC CHRnFH++ EPS71642.1 3 VVTYEECRKNHAAGIGKFAVDGCCEFMPA-GEEGSGAALRCAACSCHRNFHKKV 55 699***********************9.999*****************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-15	4	54	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.7E-27	4	55	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.5E-25	5	54	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.115	6	55	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
ERVVTYEECR KNHAAGIGKF AVDGCCEFMP AGEEGSGAAL RCAACSCHRN FHKKVVR

Functional Description ? help Back to Top
Source	Description
UniProt	Essential protein. Putative transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010246148.1	4e-24	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9SB61	9e-20	ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBL	S8EG59	3e-33	S8EG59_9LAMI; Uncharacterized protein (Fragment)
STRING	Migut.L01769.1.p	1e-32	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24660.1	4e-22	homeobox protein 22

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA Seed tolerance to deterioration in arabidopsis is affected by virus infection. Plant Physiol. Biochem., 2017. 116: p. 1-8 [PMID:28477474]