PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Function |

Regulation |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

EPS70697.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

ZF-HD

Protein Properties

Length: 75aa MW: 8458.73 Da PI: 9.5937

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS70697.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	84.4	1.3e-26	23	74	3	56
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 +vrY eC kN+Aa++G havDGC+Ef+p ++ + al+CaACgCHRnFHRr+ EPS70697.1 23 AVRYAECEKNQAADVGRHAVDGCREFLPCGDR--EDGALTCAACGCHRNFHRRK 74 589***********************9444..699*************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	8.0E-14	1	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.2E-24	24	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.8E-22	25	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	21.654	26	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MKKIHVVVRQ SNVRKRATST IFAVRYAECE KNQAADVGRH AVDGCREFLP CGDREDGALT 60 CAACGCHRNF HRRKI

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028108012.1	1e-24	mini zinc finger protein 2-like
Swissprot	Q2Q493	2e-22	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	S8EDQ4	9e-48	S8EDQ4_9LAMI; Uncharacterized protein (Fragment)
STRING	Solyc03g116070.1.1	2e-23	(Solanum lycopersicum)
STRING	fgenesh2_kg.1__2061__AT1G18835.1	2e-23	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18835.1	8e-25	mini zinc finger

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]