![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS69508.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 118aa MW: 13082.7 Da PI: 5.2681 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.8 | 2.8e-57 | 21 | 116 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 r+q+r+lPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe+yvepl+vy++kyre+egek EPS69508.1 21 RDQERLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMSTLGFEEYVEPLRVYVSKYREMEGEK 116 89*******************************************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.1E-52 | 18 | 116 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.42E-39 | 23 | 116 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.1E-28 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-21 | 54 | 72 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 57 | 73 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-21 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 1.4E-21 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MADSDNDSGG HGHGAGASVN RDQERLLPIA NVSRIMKKAL PANAKISKDA KETVQECVSE 60 FISFVTGEAS DKCQREKRKT INGDDLLWAM STLGFEEYVE PLRVYVSKYR EMEGEKIS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-46 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-46 | 21 | 111 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013645176.1 | 3e-70 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_013673068.1 | 2e-70 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 1e-70 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | S8E1H8 | 7e-83 | S8E1H8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Bo5g126550.1 | 3e-69 | (Brassica oleracea) | ||||
STRING | XP_004305679.1 | 4e-69 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-64 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|