PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB

Protein Properties

Length: 130aa MW: 14908.3 Da PI: 10.5808

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS66626.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.6	1.2e-17	14	62	1	48
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd +l+++v + G+g tW + ++++g++R++k+c++rw++yl EPS66626.1 14 RGPWSPEEDSKLKEYVSKNGTGgTWIALPQKVGLKRCGKSCRLRWLNYL 62 89**********************************************7 PP
2	Myb_DNA-binding	39.3	1.5e-12	69	111	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g ++ eEd ++ ++ + G++ W+ a++++ gRt++++k++w++ EPS66626.1 69 GEFSDEEDRIIFNLYATIGSR-WSIMAARLP-GRTDNDIKNYWNT 111 789****************.*****.*********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.936	9	66	IPR017930	Myb domain
SuperFamily	SSF46689	4.79E-27	11	109	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-11	13	64	IPR001005	SANT/Myb domain
Pfam	PF00249	2.0E-16	14	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-23	15	69	IPR009057	Homeodomain-like
CDD	cd00167	8.29E-8	16	62	No hit	No description
SMART	SM00717	1.6E-12	67	115	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	15.702	67	117	IPR017930	Myb domain
Pfam	PF00249	2.6E-11	69	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.23E-8	70	113	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.0E-24	70	117	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MGRAPCCARA SVKRGPWSPE EDSKLKEYVS KNGTGGTWIA LPQKVGLKRC GKSCRLRWLN 60 YLRPNLKHGE FSDEEDRIIF NLYATIGSRW SIMAARLPGR TDNDIKNYWN TKLKKKLLIG 120 IPRPNDINFN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-28	14	117	7	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269\|PubMed:26124109, ECO:0000269\|PubMed:26371322}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269\|PubMed:24517883, ECO:0000269\|PubMed:26371322}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010101625.1	1e-74	transcription factor RAX2
Swissprot	Q9FKL2	7e-71	MYB36_ARATH; Transcription factor MYB36
TrEMBL	S8CP65	6e-91	S8CP65_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_010101625.1	5e-74	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G57620.1	3e-73	myb domain protein 36

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Fernández-Marcos M, et al. Control of Arabidopsis lateral root primordium boundaries by MYB36. New Phytol., 2017. 213(1): p. 105-112 [PMID:27891649]