PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS66445.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 187aa MW: 20723.4 Da PI: 9.3464 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 214 | 1.4e-66 | 12 | 149 | 1 | 138 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePl 99 svyk+kaa++v+++ p+f++l sg++k++++G++ll++a+a++ r+ydW +kq f+ls+te++++++l++++sceffhdp +++s+eG+vrk+lkvePl EPS66445.1 12 SVYKGKAAITVEPRPPEFSSLGSGAFKVSKEGFVLLQFAPAVGSRQYDWTRKQIFSLSVTEIGNIISLGARDSCEFFHDPNKGKSDEGRVRKVLKVEPL 110 79************************************************************************************************* PP Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138 pdGsG+f+nlsv+n++++++es+++P+++aefavl s l EPS66445.1 111 PDGSGHFFNLSVQNKITNVDESIYIPITRAEFAVLVSSL 149 ***********************************8876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.30.31.10 | 3.5E-78 | 2 | 173 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 5.73E-74 | 5 | 185 | IPR009044 | ssDNA-binding transcriptional regulator |
Pfam | PF08536 | 3.4E-62 | 13 | 146 | IPR013742 | Plant transcription factor |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0009508 | Cellular Component | plastid chromosome | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0042162 | Molecular Function | telomeric DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
GQLPPRVYAG YSVYKGKAAI TVEPRPPEFS SLGSGAFKVS KEGFVLLQFA PAVGSRQYDW 60 TRKQIFSLSV TEIGNIISLG ARDSCEFFHD PNKGKSDEGR VRKVLKVEPL PDGSGHFFNL 120 SVQNKITNVD ESIYIPITRA EFAVLVSSLN FIVPYLLGWH AFASSVKPED SSSTRSNSRT 180 VDFEWSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 1e-102 | 1 | 186 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 1e-102 | 1 | 186 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 1e-102 | 1 | 186 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 1e-102 | 1 | 186 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011087065.2 | 1e-115 | single-stranded DNA-binding protein WHY1, chloroplastic | ||||
Swissprot | Q9LL85 | 1e-103 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
TrEMBL | S8CIA8 | 1e-134 | S8CIA8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.L01333.1.p | 1e-113 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7731 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14410.1 | 1e-104 | ssDNA-binding transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|