PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS66166.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 87aa MW: 10123.4 Da PI: 9.5142 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 95.3 | 4.2e-30 | 14 | 72 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG K+vk+s +prsYY Ct++ C vkk+++r a+d+++v++tYeg Hnh+ EPS66166.1 14 LDDGYKWRKYGHKSVKNSSHPRSYYCCTHHACGVKKQIQRLANDKSIVVTTYEGIHNHP 72 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.1E-31 | 2 | 73 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.18E-27 | 6 | 73 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 26.808 | 9 | 74 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.9E-32 | 14 | 73 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.0E-24 | 15 | 72 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
QRVAFHTRSE QDVLDDGYKW RKYGHKSVKN SSHPRSYYCC THHACGVKKQ IQRLANDKSI 60 VVTTYEGIHN HPSQNLLETL TPLLQFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-25 | 4 | 71 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-25 | 4 | 71 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019160501.1 | 7e-47 | PREDICTED: probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 3e-45 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | S8CMZ8 | 2e-59 | S8CMZ8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Cagra.0062s0038.1.p | 2e-44 | (Capsella grandiflora) | ||||
STRING | XP_006301676.1 | 2e-44 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6374 | 24 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 4e-41 | WRKY DNA-binding protein 56 |
Publications ? help Back to Top | |||
---|---|---|---|
|