PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS65189.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 101aa MW: 11136.7 Da PI: 10.7035 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.7 | 8.9e-32 | 40 | 96 | 3 | 59 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++er+ + +++++itY+g H+h EPS65189.1 40 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIERALDGTTALVITYKGVHDHG 96 9*******************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.5E-32 | 23 | 98 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-28 | 32 | 98 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.192 | 33 | 98 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.7E-35 | 38 | 97 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-24 | 40 | 95 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
EIGRQKKNSS SSSSSSSLLK PGKKPKFVVH AADDVGISGD GYRWRKYGQK MVKGNPHPRN 60 YYRCTSAGCP VRKHIERALD GTTALVITYK GVHDHGMPVP R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 2e-28 | 26 | 98 | 2 | 74 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028079096.1 | 4e-52 | probable WRKY transcription factor 32 | ||||
Swissprot | P59583 | 5e-49 | WRK32_ARATH; Probable WRKY transcription factor 32 | ||||
TrEMBL | S8CDY8 | 1e-68 | S8CDY8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_008242986.1 | 4e-51 | (Prunus mume) | ||||
STRING | EMJ05298 | 4e-51 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9189 | 21 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G30935.1 | 3e-48 | WRKY DNA-binding protein 32 |
Publications ? help Back to Top | |||
---|---|---|---|
|