PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

NAC

Protein Properties

Length: 178aa MW: 20674.6 Da PI: 8.5912

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS63951.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	171.2	3.3e-53	22	150	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 lppGfrFhPtdeelv++yL+ kv + ++evd++++ePw+Lp ++k +e+ewyfFs rd+ky+tg r+nrat++gyWkatgkd+ev+ + +g+ EPS63951.1 22 LPPGFRFHPTDEELVTFYLASKVFNGGYLRGLEMAEVDLNRCEPWELPDAAKMGEREWYFFSLRDRKYPTGLRTNRATTAGYWKATGKDREVYGSaGGS 120 79******************99999555345***********8888999**********************************987889 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 l g+kktLvfy+grap+gekt+Wvmheyrl EPS63951.1 121 LLGMKKTLVFYRGRAPRGEKTKWVMHEYRL 150 9*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.31E-61	20	172	IPR003441	NAC domain
PROSITE profile	PS51005	59.657	22	172	IPR003441	NAC domain
Pfam	PF02365	1.1E-28	23	150	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010014	Biological Process	meristem initiation
GO:0010199	Biological Process	organ boundary specification between lateral organs and the meristem
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MLRVEEILCE LERDGDDTKT GLPPGFRFHP TDEELVTFYL ASKVFNGGYL RGLEMAEVDL 60 NRCEPWELPD AAKMGEREWY FFSLRDRKYP TGLRTNRATT AGYWKATGKD REVYGSAGGS 120 LLGMKKTLVF YRGRAPRGEK TKWVMHEYRL DGDFSCRHTG KEEWVICRIF HKISDKKS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-51	18	177	13	170	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-51	18	177	13	170	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-51	18	177	13	170	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-51	18	177	13	170	NO APICAL MERISTEM PROTEIN
3swm_A	1e-51	18	177	16	173	NAC domain-containing protein 19
3swm_B	1e-51	18	177	16	173	NAC domain-containing protein 19
3swm_C	1e-51	18	177	16	173	NAC domain-containing protein 19
3swm_D	1e-51	18	177	16	173	NAC domain-containing protein 19
3swp_A	1e-51	18	177	16	173	NAC domain-containing protein 19
3swp_B	1e-51	18	177	16	173	NAC domain-containing protein 19
3swp_C	1e-51	18	177	16	173	NAC domain-containing protein 19
3swp_D	1e-51	18	177	16	173	NAC domain-containing protein 19
4dul_A	1e-51	18	177	13	170	NAC domain-containing protein 19
4dul_B	1e-51	18	177	13	170	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00241	DAP	Transfer from AT1G76420	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011074066.1	1e-110	protein CUP-SHAPED COTYLEDON 3
Swissprot	Q9S851	1e-95	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	S8CHB6	1e-129	S8CHB6_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_009616121.1	1e-104	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA152	24	279

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76420.1	5e-98	NAC family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]