![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS63761.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 112aa MW: 12712.5 Da PI: 9.5855 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 33.1 | 1.2e-10 | 33 | 93 | 4 | 64 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 kr++r NR +A rs +RK +i eLe k+ +L++e +aL ++l +l+ + +l+++++ EPS63761.1 33 PKRAKRILANRKSAARSKERKMRYITELELKIGTLQGEASALCSQLAMLQRDSIQLTDQNK 93 59*************************************************9999999885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-12 | 30 | 94 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.036 | 32 | 95 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.3E-10 | 34 | 88 | No hit | No description |
SuperFamily | SSF57959 | 5.56E-11 | 34 | 90 | No hit | No description |
Pfam | PF00170 | 5.0E-9 | 34 | 93 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14703 | 2.12E-14 | 35 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
DAAVELSSNE FTEDEMKKIR GNKKLSEIAS ADPKRAKRIL ANRKSAARSK ERKMRYITEL 60 ELKIGTLQGE ASALCSQLAM LQRDSIQLTD QNKELKYRLQ ALEQQAQLED GM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007017723.1 | 2e-44 | PREDICTED: uncharacterized protein LOC18591502 | ||||
Refseq | XP_021283650.1 | 3e-44 | uncharacterized protein LOC110416125 | ||||
Refseq | XP_021283651.1 | 3e-44 | uncharacterized protein LOC110416125 | ||||
Refseq | XP_021283652.1 | 3e-44 | uncharacterized protein LOC110416125 | ||||
Swissprot | Q6S4P4 | 8e-34 | RF2B_ORYSJ; Transcription factor RF2b | ||||
TrEMBL | S8CGP1 | 2e-73 | S8CGP1_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | EOY14948 | 9e-44 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2507 | 23 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38900.3 | 6e-37 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|