 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
EPS63761.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
Family |
bZIP |
Protein Properties |
Length: 112aa MW: 12712.5 Da PI: 9.5855 |
Description |
bZIP family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
EPS63761.1 | genome | LSMU | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | bZIP_1 | 33.1 | 1.2e-10 | 33 | 93 | 4 | 64 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64
kr++r NR +A rs +RK +i eLe k+ +L++e +aL ++l +l+ + +l+++++
EPS63761.1 33 PKRAKRILANRKSAARSKERKMRYITELELKIGTLQGEASALCSQLAMLQRDSIQLTDQNK 93
59*************************************************9999999885 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}. |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Dai S,Zhang Z,Bick J,Beachy RN
Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] - Liu Y,Dai S,Beachy RN
Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] - Dai S, et al.
Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] - Leushkin EV, et al.
The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]
|