PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS62609.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 73aa MW: 8517.83 Da PI: 11.3092 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.2 | 2.9e-16 | 2 | 47 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+++++++ +lG g+Wk I++ + k+R+ q+ s+ qky EPS62609.1 2 MPWTEEEHKKFLEGLDKLGRGNWKGISKIFVKTRSSTQVASHAQKY 47 69*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.2E-7 | 1 | 50 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.124 | 1 | 52 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.59E-18 | 2 | 53 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 8.1E-14 | 2 | 47 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.4E-18 | 2 | 51 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 4.0E-11 | 3 | 47 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.76E-9 | 3 | 48 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
GMPWTEEEHK KFLEGLDKLG RGNWKGISKI FVKTRSSTQV ASHAQKYFLR KSSMDKRKRR 60 NSVFDVRIVS AFS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269|PubMed:12172034}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q7XC51}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006601240.2 | 4e-30 | transcription factor MYBS3, partial | ||||
Swissprot | B8BI93 | 3e-29 | MYBS2_ORYSI; Transcription factor MYBS2 | ||||
Swissprot | Q7XC51 | 3e-29 | MYBS2_ORYSJ; Transcription factor MYBS2 | ||||
TrEMBL | S8C745 | 4e-46 | S8C745_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Traes_1AL_F7D2C31DB.1 | 7e-30 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3385 | 21 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 2e-30 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|