![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS61700.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 107aa MW: 12113.9 Da PI: 9.341 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58 | 2.2e-18 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd++l+ +++++G+g +W + ++++g++R++k+c++rw++yl EPS61700.1 14 RGPWSPEEDDKLKSYIEKHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62 89**********************************************7 PP | |||||||
2 | Myb_DNA-binding | 32.6 | 1.8e-10 | 69 | 107 | 2 | 42 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 g +T+eEd l+ + G++ W+ Ia+ ++ gRt++++k+ EPS61700.1 69 GGFTEEEDNLICSLYITIGSR-WSIIAAQLP-GRTDNDIKN 107 569******************.*********.*******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.121 | 9 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.04E-27 | 11 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-13 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-17 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-26 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.59E-10 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 12.874 | 67 | 107 | IPR017930 | Myb domain |
SMART | SM00717 | 0.59 | 67 | 107 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-9 | 69 | 107 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.3E-18 | 70 | 107 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.97E-6 | 71 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MGRAPCCDKA NVKRGPWSPE EDDKLKSYIE KHGTGGNWIA LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FTEEEDNLIC SLYITIGSRW SIIAAQLPGR TDNDIKN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-22 | 14 | 107 | 7 | 98 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003550958.1 | 2e-75 | transcription factor RAX3 | ||||
Refseq | XP_028209813.1 | 2e-75 | transcription factor RAX3-like | ||||
Swissprot | Q9M2Y9 | 5e-71 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A445G7C2 | 5e-74 | A0A445G7C2_GLYSO; Transcription factor RAX3 | ||||
TrEMBL | I1MVH6 | 5e-74 | I1MVH6_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G16980.1 | 9e-75 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49690.1 | 2e-73 | myb domain protein 84 |
Publications ? help Back to Top | |||
---|---|---|---|
|