PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS60120.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 123aa MW: 14522.3 Da PI: 7.1292 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38 | 3.7e-12 | 21 | 73 | 5 | 57 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 ++ rr+ +NRe+ArrsR RK+ ++eL v L +eN L ++l++ ++ + EPS60120.1 21 RKRRRMKSNRESARRSRMRKQRHLDELWSQVLRLRTENNHLLDKLNHVTQSHD 73 56789999*************************************99988665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 5.8E-16 | 17 | 81 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.358 | 19 | 82 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.63E-12 | 21 | 71 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 4.6E-11 | 21 | 94 | No hit | No description |
Pfam | PF00170 | 7.2E-10 | 21 | 69 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 7.14E-17 | 22 | 73 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 24 | 39 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
ISNLSTNVED EGNQLSVVDE RKRRRMKSNR ESARRSRMRK QRHLDELWSQ VLRLRTENNH 60 LLDKLNHVTQ SHDRIVQENE KLKDEASDLH QMLMDIQFCN IFTCISDFED MSCNLTHLAA 120 AST |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 20 | 24 | RKRRR |
2 | 33 | 40 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011077776.1 | 5e-53 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 2e-31 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | S8BZT5 | 1e-83 | S8BZT5_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_009794536.1 | 3e-49 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 9e-39 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|