PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

G2-like

Protein Properties

Length: 145aa MW: 16119.4 Da PI: 8.6895

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59635.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	104.8	5.1e-33	22	76	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt +LHerFv+av+qLGG+ kAtPk+il++m+vkgLtl h+kSHLQkYRl EPS59635.1 22 KPRLRWTADLHERFVDAVTQLGGATKATPKAILRTMGVKGLTLFHLKSHLQKYRL 76 79****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	10.579	19	79	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	7.1E-32	19	77	IPR009057	Homeodomain-like
SuperFamily	SSF46689	6.63E-17	22	78	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.2E-24	22	77	IPR006447	Myb domain, plants
Pfam	PF00249	2.7E-8	24	75	IPR001005	SANT/Myb domain
Pfam	PF14379	9.3E-8	117	138	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 145 aa Download sequence Send to blast
PAYGQRLPCG EPCMVQLTSD PKPRLRWTAD LHERFVDAVT QLGGATKATP KAILRTMGVK 60 GLTLFHLKSH LQKYRLGKQS GKELGESSKD GVYAMDSPLS SDSHQNLHSS DMNDGYEVKE 120 ALRAQMEVQS QLHLQVEVSP LYNKI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	2e-20	22	78	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	2e-20	22	78	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	2e-20	22	78	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	2e-20	22	78	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269\|PubMed:26586833}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269\|PubMed:26586833}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011086304.1	2e-72	protein PHR1-LIKE 2-like
Swissprot	Q94A57	3e-54	PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBL	S8BYF1	1e-104	S8BYF1_9LAMI; Uncharacterized protein (Fragment)
STRING	Migut.M01478.1.p	9e-72	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA9764	20	27

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24120.1	1e-56	G2-like family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885]