![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS57629.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 116aa MW: 13452.1 Da PI: 8.2362 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 62.1 | 9.9e-20 | 1 | 38 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rsYYrCt+++Cpvkk+vers +dp++v++tYeg+Hnh+ EPS57629.1 1 RSYYRCTTPKCPVKKRVERSFQDPSIVITTYEGQHNHQ 38 9************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 19.393 | 1 | 40 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.35E-15 | 1 | 40 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-13 | 1 | 38 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.3E-11 | 1 | 39 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 9.5E-18 | 1 | 40 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
RSYYRCTTPK CPVKKRVERS FQDPSIVITT YEGQHNHQVP ATLRGSIAGL FAPPMMIPSL 60 QLENSTVHRD LLHLYGYDSA AEFYRQRSFH PAQQQHQKHD ESTQYSDYGL LQDMIP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-14 | 1 | 41 | 38 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-14 | 1 | 41 | 38 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022898810.1 | 6e-36 | probable WRKY transcription factor 28 | ||||
TrEMBL | S8BTA2 | 8e-82 | S8BTA2_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | EOY27787 | 1e-31 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1485 | 24 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29860.1 | 5e-26 | WRKY DNA-binding protein 71 |
Publications ? help Back to Top | |||
---|---|---|---|
|