PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

YABBY

Protein Properties

Length: 52aa MW: 6013.76 Da PI: 9.1945

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS57246.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	72.7	1.3e-22	1	38	132	169
YABBY 132 fikeeiqrikasnPdishreafsaaaknWahfPkihfg 169 f +eeiqrikasnP+ishr+afs+aaknWah+P+ih g EPS57246.1 1 FFREEIQRIKASNPEISHRQAFSTAAKNWAHYPDIHIG 38 889*********************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	8.4E-21	1	39	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 52 aa Download sequence Send to blast
FFREEIQRIK ASNPEISHRQ AFSTAAKNWA HYPDIHIGMK MEASPPTKTT DQ

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010557447.1	5e-20	PREDICTED: putative axial regulator YABBY 2
Swissprot	Q9XFB0	3e-20	YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBL	S8BYJ5	5e-31	S8BYJ5_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_010557447.1	2e-19	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA381	24	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	1e-22	YABBY family protein

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148]