|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
EMT32696 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
Family |
M-type_MADS |
Protein Properties |
Length: 79aa MW: 8954.43 Da PI: 10.2363 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
EMT32696 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 95.8 | 1.9e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
kri+nk+ rqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++g+l+e+s+
EMT32696 9 KRIDNKISRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGRLFEFST 59
79***********************************************96 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-20 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. |
UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:16217607, ECO:0000269|PubMed:9085264, ECO:0000269|Ref.8}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AM502886 | 2e-96 | AM502886.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM20 (WM20 gene). |
GenBank | DQ512359 | 2e-96 | DQ512359.1 Triticum aestivum MADS-box transcription factor TaAGL8 (AGL8) mRNA, complete cds. |
GenBank | DQ512362 | 2e-96 | DQ512362.1 Triticum aestivum MADS-box transcription factor TaAGL5 (AGL5) mRNA, complete cds. |
GenBank | DQ534491 | 2e-96 | DQ534491.1 Triticum aestivum MADS3 mRNA, complete cds. |