![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT32483 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 100aa MW: 11471.4 Da PI: 10.2396 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.6 | 6e-18 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l+ +++++G +W++ ++ g+ R++k+c++rw +yl EMT32483 16 RGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63 89******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.5E-25 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.335 | 11 | 67 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-16 | 16 | 63 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.99E-25 | 17 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.43E-11 | 18 | 63 | No hit | No description |
PROSITE profile | PS50090 | 4.495 | 64 | 91 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-10 | 67 | 91 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MGKGRAPCCA KVGLNRGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI 60 NYLRPDLKRG NFTVEEEETL IKLHNMLGNK YVHHLPLAAP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-17 | 14 | 92 | 25 | 102 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK248649 | 1e-124 | AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence. | |||
GenBank | AK369689 | 1e-124 | AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020185012.1 | 3e-62 | myb-related protein Zm1-like | ||||
Swissprot | P20024 | 2e-55 | MYB1_MAIZE; Myb-related protein Zm1 | ||||
TrEMBL | A0A453CWE4 | 4e-69 | A0A453CWE4_AEGTS; Uncharacterized protein | ||||
STRING | EMT32483 | 2e-69 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2154 | 37 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79180.1 | 7e-53 | myb domain protein 63 |
Publications ? help Back to Top | |||
---|---|---|---|
|