![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT32159 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 117aa MW: 12605.4 Da PI: 6.9564 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 99.4 | 2.6e-31 | 25 | 86 | 40 | 101 |
NF-YC 40 saeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101 aeaPv++++ace+filelt r w haeenkrrtl+ksdiaaa++rt++fdflvdivprde EMT32159 25 PAEAPVVFARACEMFILELTHRGWAHAEENKRRTLQKSDIAAAIARTEVFDFLVDIVPRDEA 86 59**********************************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 6.04E-19 | 22 | 83 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 3.2E-24 | 24 | 83 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.8E-10 | 26 | 68 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MASHATGKRT ARTTSLPGKP LGVTPAEAPV VFARACEMFI LELTHRGWAH AEENKRRTLQ 60 KSDIAAAIAR TEVFDFLVDI VPRDEAKDAE AAVAAGMPHP AAGMPAADMG YYYVPQQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 1e-31 | 26 | 83 | 38 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 55 | 61 | RRTLQKS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK361494 | 1e-137 | AK361494.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1141P02. | |||
GenBank | AK372295 | 1e-137 | AK372295.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2149D08. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020160105.1 | 4e-61 | nuclear transcription factor Y subunit C-6-like | ||||
Swissprot | Q9XE33 | 1e-43 | NFYC6_ORYSJ; Nuclear transcription factor Y subunit C-6 | ||||
TrEMBL | M8CCN9 | 3e-80 | M8CCN9_AEGTA; Nuclear transcription factor Y subunit C-2 | ||||
STRING | EMT32159 | 4e-81 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3856 | 36 | 76 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54830.3 | 7e-32 | nuclear factor Y, subunit C3 |
Publications ? help Back to Top | |||
---|---|---|---|
|