PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

WRKY

Protein Properties

Length: 150aa MW: 16761.5 Da PI: 8.2237

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT29146	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	89	4e-28	62	120	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vk +v +++dp +v++tYeg+H h EMT29146 62 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKERVGGDRDDPAYVVTTYEGTHSHV 120 59*******************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.4E-30	48	122	IPR003657	WRKY domain
SuperFamily	SSF118290	1.24E-25	54	122	IPR003657	WRKY domain
PROSITE profile	PS50811	28.587	57	122	IPR003657	WRKY domain
SMART	SM00774	5.7E-29	62	121	IPR003657	WRKY domain
Pfam	PF03106	3.4E-22	63	119	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MGQMFANPSG HIHGQPVEWR PSNDILHFKT VDNELLAESA AAAERPRTER IAFRTRTEIE 60 ILDDGYKWRK YGKKSVKNSP NPRNYYRCST EGCSVKERVG GDRDDPAYVV TTYEGTHSHV 120 SPSTVYYASQ DAASGRFFVA GTHPPPGSLN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ayd_A	1e-22	50	122	2	74	WRKY transcription factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KR827402	0.0	KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020192531.1	2e-73	probable WRKY transcription factor 51
Swissprot	Q93WU9	9e-37	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	M8CZ47	1e-109	M8CZ47_AEGTA; Uncharacterized protein
STRING	EMT29146	1e-110	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	1e-36	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]