 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
EMT26190 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
Family |
MYB |
Protein Properties |
Length: 88aa MW: 10152.8 Da PI: 9.0646 |
Description |
MYB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
EMT26190 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 57.7 | 2.7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+ ++k +G g+W++ ++ g+ R++k+c++rw +yl
EMT26190 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
79******************************99************97 PP
|
2 | Myb_DNA-binding | 22.2 | 3.2e-07 | 67 | 88 | 1 | 22 |
TSSS-HHHHHHHHHHHHHTTTT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg 22
rg++T+eEdel+++++++lG++
EMT26190 67 RGNFTEEEDELIIKLHELLGNK 88
89******************96 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | BT054758 | 1e-108 | BT054758.1 Zea mays full-length cDNA clone ZM_BFb0028G03 mRNA, complete cds. |
GenBank | KJ726796 | 1e-108 | KJ726796.1 Zea mays clone pUT2285 MYB transcription factor (MYB64) mRNA, partial cds. |
Publications
? help Back to Top |
- Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Schenke D,Cai D,Scheel D
Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] - Zhou M, et al.
Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] - Zhang J, et al.
Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] - Zhou M, et al.
LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] - Mondal SK,Roy S
Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] - Verma N,Burma PK
Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]
|