![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT24804 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 96aa MW: 10609.8 Da PI: 6.9048 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 88.4 | 7.1e-28 | 22 | 78 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 vrY+eC++NhA+ +G +avDGC+Ef+ g + +aa l CaACgCHRnFHRrev++e EMT24804 22 YVRYRECQRNHAIGIGRYAVDGCQEFTVLMGVD-EAAMLLCAACGCHRNFHRREVVNE 78 589*************************97776.9999****************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 7.7E-26 | 23 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 3.0E-14 | 23 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 6.7E-23 | 24 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 21.303 | 25 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048509 | Biological Process | regulation of meristem development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MGSRQDQPAV NGEQGNGAGA AYVRYRECQR NHAIGIGRYA VDGCQEFTVL MGVDEAAMLL 60 CAACGCHRNF HRREVVNEFG VDYHAPRTPP ADENRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 1e-135 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020180776.1 | 5e-66 | mini zinc finger protein 3-like | ||||
Swissprot | Q2Q493 | 3e-19 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | A0A453GFF8 | 1e-64 | A0A453GFF8_AEGTS; Uncharacterized protein | ||||
TrEMBL | M8BS58 | 1e-64 | M8BS58_AEGTA; Uncharacterized protein | ||||
STRING | EMT24804 | 2e-65 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 1e-21 | mini zinc finger |