PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

MYB

Protein Properties

Length: 263aa MW: 28767.9 Da PI: 6.8512

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT21544	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.1	4.7e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd++l+d+++q+G +W++ +++ g+ R++k+c++rw +yl EMT21544 14 RGAWSPEEDQRLADYIAQHGHSNWRALPKHAGLLRCGKSCRLRWVNYL 61 89****************************99**********97 PP
2	Myb_DNA-binding	49.9	7.2e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+++++++++ lG++ W+ Ia+ ++ gRt++++k+ w+++l EMT21544 67 RGNFTADEEDRIIRLHQALGNR-WSVIAAQLP-GRTDNEIKNVWHSHL 112 89******************.*****.*********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.315	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	2.24E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.8E-17	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.8E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	1.17E-11	16	61	No hit	No description
PROSITE profile	PS51294	23.624	62	116	IPR017930	Myb domain
SMART	SM00717	2.6E-13	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	7.78E-10	69	112	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.2E-26	69	116	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 263 aa Download sequence Send to blast
MGRAPCCEKD GLKRGAWSPE EDQRLADYIA QHGHSNWRAL PKHAGLLRCG KSCRLRWVNY 60 LSPDIKRGNF TADEEDRIIR LHQALGNRWS VIAAQLPGRT DNEIKNVWHS HLKKRLEDGL 120 KPAADHDAGG SGRQKSRKQA KARSATVDAR ERHTSLQGQS SSGLTCSTVT ESAAAVTSSP 180 SDNATITSAS HGHQLVKEDT FSSEAVTDNS FLSSTDVTGM IDLGAMGEDL SLVMSSSSTW 240 SDDQDFWINM LQEGGDIIDL PKL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-26	12	117	5	109	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF951916	0.0	JF951916.1 Triticum urartu clone TaMYB33 R2R3-MYB protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020157253.1	0.0	myb-related protein Myb4-like
Swissprot	Q9LTC4	9e-75	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A3B5ZTZ9	0.0	A0A3B5ZTZ9_WHEAT; Uncharacterized protein
TrEMBL	A0A452YG62	0.0	A0A452YG62_AEGTS; Uncharacterized protein
TrEMBL	M8BHT6	0.0	M8BHT6_AEGTA; Myb-related protein Myb4
STRING	EMT21544	0.0	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP79	38	563

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	6e-77	myb domain protein 15

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]