|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
EMT18227 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
Family |
M-type_MADS |
Protein Properties |
Length: 68aa MW: 7562.7 Da PI: 10.8138 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
EMT18227 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 77.1 | 1.3e-24 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k ie+ + rqv fskRr g+ KA+ LSvLCdaeva+i+fss+g+lye+++
EMT18227 9 KLIEDRTSRQVAFSKRRSGLHRKAFQLSVLCDAEVALIVFSSNGRLYEFAN 59
569**********************************************85 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
1tqe_R | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
1tqe_S | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
5f28_A | 9e-19 | 1 | 63 | 1 | 63 | MEF2C |
5f28_B | 9e-19 | 1 | 63 | 1 | 63 | MEF2C |
5f28_C | 9e-19 | 1 | 63 | 1 | 63 | MEF2C |
5f28_D | 9e-19 | 1 | 63 | 1 | 63 | MEF2C |
6c9l_A | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
6c9l_B | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
6c9l_C | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
6c9l_D | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
6c9l_E | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
6c9l_F | 8e-19 | 1 | 63 | 1 | 63 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Publications
? help Back to Top |
- Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR
Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] - Park SJ, et al.
Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] - Lee S,Jeong DH,An G
A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] - Maas LF,McClung A,McCouch S
Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] - Sun C, et al.
The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] - Choi SC, et al.
Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] - Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM
Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] - Jin J, et al.
MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] - Liu X, et al.
Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] - Hwang YH, et al.
Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] - Shibaya T, et al.
Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] - Alter P, et al.
Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]
|