 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
EMT14108 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
Family |
Dof |
Protein Properties |
Length: 117aa MW: 12724.3 Da PI: 10.0259 |
Description |
Dof family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
EMT14108 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 97.7 | 8.2e-31 | 56 | 103 | 2 | 49 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49
++++l+cprC st+tkfCyynnys++qPr++C++CrryWt+GG+lrnv
EMT14108 56 QQAKLECPRCSSTDTKFCYYNNYSTTQPRHYCRTCRRYWTHGGTLRNV 103
67899******************************************9 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0003677 | Molecular Function | DNA binding |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | FJ687390 | 1e-137 | FJ687390.1 Triticum aestivum Dof transcription factor 4 (Dof4) mRNA, complete cds. |