PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT09005 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 80aa MW: 9255.58 Da PI: 9.46 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 77.5 | 1.6e-24 | 38 | 75 | 2 | 39 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEE CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkve 39 dDgy+WrKYGqK +k+s++prsYYrCt ++C++kk+v+ EMT09005 38 DDGYKWRKYGQKAIKNSPNPRSYYRCTNPRCNAKKQVD 75 8************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.6E-22 | 32 | 75 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 21.172 | 32 | 80 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-20 | 35 | 77 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.1E-17 | 37 | 80 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.6E-19 | 38 | 75 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MEEMGEESSR VFSPEKVLGK MENKYTMKIK SCGNGLADDG YKWRKYGQKA IKNSPNPRSY 60 YRCTNPRCNA KKQVDIIELD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 9e-15 | 36 | 80 | 16 | 60 | Probable WRKY transcription factor 4 |
2lex_A | 9e-15 | 36 | 80 | 16 | 60 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 1e-76 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020198801.1 | 1e-40 | probable WRKY transcription factor 48 | ||||
Swissprot | Q9FHR7 | 1e-24 | WRK49_ARATH; Probable WRKY transcription factor 49 | ||||
TrEMBL | M8B5W5 | 1e-52 | M8B5W5_AEGTA; Putative WRKY transcription factor 49 | ||||
STRING | EMT09005 | 2e-53 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7525 | 35 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G43290.1 | 6e-27 | WRKY DNA-binding protein 49 |