PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

bZIP

Protein Properties

Length: 90aa MW: 10868.2 Da PI: 9.1109

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT05452	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	46	1.1e-14	8	60	3	55
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+e +L e ee +++ EMT05452 8 ATQRQKRMIKNRESAARSRERKQAYIAELEAQVTQLEEEHAELLREQEEQNEK 60 679*************************************9988776655544 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.3E-10	5	71	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	4.9E-13	8	67	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.944	8	72	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.69E-12	11	59	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.7E-14	11	68	No hit	No description
PROSITE pattern	PS00036	0	13	28	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MDPMDRAATQ RQKRMIKNRE SAARSRERKQ AYIAELEAQV TQLEEEHAEL LREQEEQNEK 60 RLNELKEQAF QVVVRKKPSQ DLRRTNSMEW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00648	PBM	Transfer from LOC_Os05g36160	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT224373	1e-149	KT224373.1 Triticum aestivum cultivar RAC875 bZIP2 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020178558.1	4e-58	G-box-binding factor 4-like
Swissprot	Q0JHF1	9e-42	BZP12_ORYSJ; bZIP transcription factor 12
TrEMBL	A0A3B5Y2K6	7e-57	A0A3B5Y2K6_WHEAT; Uncharacterized protein
STRING	BRADI2G24120.3	2e-57	(Brachypodium distachyon)
STRING	MLOC_53321.1	2e-57	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2665	37	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G44080.1	3e-17	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]