![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT05172 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 114aa MW: 12268.2 Da PI: 5.5738 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 77.2 | 2.1e-24 | 49 | 97 | 11 | 60 |
ZF-HD_dimer 11 kNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 + hAas+Gg+avDGC+Ef+++ geegt alkC+ACgCHR+FH r +++e EMT05172 49 RTHAASTGGYAVDGCREFIAE-GEEGTFGALKCSACGCHRSFHHRVQVYE 97 78******************8.999********************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51523 | 19.388 | 44 | 93 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 6.0E-15 | 45 | 104 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 4.9E-22 | 49 | 94 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 2.1E-17 | 50 | 92 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MAQELPTTAN QASWEHSRRR ERPPRDEEAG GPEEVRADRA VRGGGPAPRT HAASTGGYAV 60 DGCREFIAEG EEGTFGALKC SACGCHRSFH HRVQVYEVAW DCESDTSSSS SSSS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK375715 | 2e-88 | AK375715.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3102E24. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020146636.1 | 9e-36 | mini zinc finger protein 3-like | ||||
Swissprot | Q0J5F8 | 4e-20 | MIF4_ORYSJ; Mini zinc finger protein 4 | ||||
TrEMBL | M8BQD1 | 9e-77 | M8BQD1_AEGTA; Uncharacterized protein | ||||
STRING | EMT05172 | 2e-77 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-21 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|