![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT03959 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 185aa MW: 20091 Da PI: 10.5184 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.7 | 2.5e-41 | 58 | 134 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +CqvegC++ l+ akeyhrrhkvCe+hskap v+v+g eqrfCqqCsrfh++ efD++krsCrrrLa+hnerrrk++ EMT03959 58 RCQVEGCHMALAGAKEYHRRHKVCEAHSKAPRVIVHGAEQRFCQQCSRFHAMAEFDDAKRSCRRRLAGHNERRRKSN 134 6**************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.2E-35 | 51 | 120 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.265 | 56 | 133 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.43E-39 | 57 | 136 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.7E-32 | 59 | 132 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0010468 | Biological Process | regulation of gene expression | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MQQELTSLKL GKRPCSLGGC QVAVAQVDGS GGGGGRAVVE GKRKEKAAGG GATASMPRCQ 60 VEGCHMALAG AKEYHRRHKV CEAHSKAPRV IVHGAEQRFC QQCSRFHAMA EFDDAKRSCR 120 RRLAGHNERR RKSNASDAMA RGSAHAHGAP QRLLATRQWS RCRWPLLAFS DVLALVIEEM 180 ASIYG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-32 | 49 | 132 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00290 | DAP | Transfer from AT2G33810 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU964656 | 3e-94 | EU964656.1 Zea mays clone 280651 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020169596.1 | 5e-87 | squamosa promoter-binding-like protein 7 | ||||
Swissprot | Q7XT42 | 2e-62 | SPL7_ORYSJ; Squamosa promoter-binding-like protein 7 | ||||
TrEMBL | M8ARA6 | 1e-131 | M8ARA6_AEGTA; Squamosa promoter-binding-like protein 7 | ||||
STRING | EMT03959 | 1e-132 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10303 | 34 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69170.1 | 7e-37 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|